Protein Info for PS417_24730 in Pseudomonas simiae WCS417

Annotation: 50S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF02590: SPOUT_MTase" amino acids 1 to 154 (154 residues), 163.1 bits, see alignment E=2.6e-52 TIGR00246: rRNA large subunit m3Psi methyltransferase RlmH" amino acids 2 to 155 (154 residues), 208.8 bits, see alignment E=2.1e-66

Best Hits

Swiss-Prot: 100% identical to RLMH_PSEFS: Ribosomal RNA large subunit methyltransferase H (rlmH) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00783, hypothetical protein (inferred from 100% identity to pfs:PFLU5424)

MetaCyc: 59% identical to 23S rRNA m3psi1915 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11592 [EC: 2.1.1.177]

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.177

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UP16 at UniProt or InterPro

Protein Sequence (155 amino acids)

>PS417_24730 50S rRNA methyltransferase (Pseudomonas simiae WCS417)
MRLRLIAVGSRMPKWVEEGWHEYAKRLPAELSLELVEIPLNTRGKNADVARFIRQEGEAM
LAKVGPNERIVTLEVHGKPWSTEQLAVELDRWRLDSRTVNFMVGGPEGLAPEVCARADQR
WSLSALTLPHPLVRILIGEQLYRAWTVLSGHPYHK