Protein Info for GFF4835 in Variovorax sp. SCN45

Annotation: LSU ribosomal protein L20p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 TIGR01032: ribosomal protein bL20" amino acids 1 to 114 (114 residues), 160.7 bits, see alignment E=7.3e-52 PF00453: Ribosomal_L20" amino acids 3 to 107 (105 residues), 157.4 bits, see alignment E=5.8e-51

Best Hits

Swiss-Prot: 100% identical to RL20_VARPS: 50S ribosomal protein L20 (rplT) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02887, large subunit ribosomal protein L20 (inferred from 99% identity to vpe:Varpa_3945)

MetaCyc: 69% identical to 50S ribosomal subunit protein L20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L20p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>GFF4835 LSU ribosomal protein L20p (Variovorax sp. SCN45)
MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL
WIARINAASRELGLTYSQFANGIRKAGIEIDRKMLADIAVHDKAAFAGIVEQVKAKLAA