Protein Info for PS417_24725 in Pseudomonas simiae WCS417

Annotation: penicillin-binding protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 20 to 607 (588 residues), 779.7 bits, see alignment E=9.9e-239 PF03717: PBP_dimer" amino acids 63 to 236 (174 residues), 150.7 bits, see alignment E=6.4e-48 PF00905: Transpeptidase" amino acids 268 to 604 (337 residues), 256.7 bits, see alignment E=2.8e-80

Best Hits

Swiss-Prot: 44% identical to MRDA_HAEIN: Peptidoglycan D,D-transpeptidase MrdA (mrdA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 98% identity to pfs:PFLU5423)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9H0 at UniProt or InterPro

Protein Sequence (632 amino acids)

>PS417_24725 penicillin-binding protein 2 (Pseudomonas simiae WCS417)
MTQPIRIKDHEKDARLVRSRVVFGAIMVVALLGVLIARLYFLQVIQYDYHSTLSENNRVH
VQPIPPTRGLIFDRNGVVVADNRPSFSLSMTRERSGDWQQILDVIVEVLQLTPEDRAIFE
KRMKQGRRPFEPVPILFELTEEQIARIAVNQFRLPGVEVVAQLVRHYPQGPHFAHSVGYM
GRINEKELKTLDPVNYSGTHHIGKTGIERFYEPELHGQVGYEEVETNARGRVLRVLKRTD
PVPGKDIVLSLDIKLQEAAEMALGGRRGAVVALDPKTGEVLAMVSQPSFDPNLFVTGISF
KAYAELRDSIDRPLFNRVLRGLYPPGSTIKPAVAIAGLDAGVVTASSRVFDPGYYMLPNY
DHKYRNWNRTGDGYVDLDTAIMRSNDTYFYDLAHKLGIDRLSAYMGKFGLGQKVSLDMFE
ESPGLMPSREWKRATRRQAWFPGETLILGIGQGYMQATPLQLAQATALVANKGIWNRPHL
AKTIEGEKPVDDNPIPDIVLRDASDWTKVNHGMQQVMHGARGTARKAAVGAQYRIAGKSG
TAQVVAIKQGEKYDRTKVQERHRDHALFVGFAPADDPKIVVAVMVENGESGSGVAAPVVR
QVMDAWLLADDGRLKPEYGGPPSSTEVTAREE