Protein Info for GFF4825 in Sphingobium sp. HT1-2

Annotation: Toxin HigB / Protein kinase domain of HipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR03071: HipA N-terminal domain" amino acids 2 to 79 (78 residues), 69.2 bits, see alignment E=1.4e-23 PF13657: Couple_hipA" amino acids 2 to 79 (78 residues), 59 bits, see alignment E=5.7e-20 PF07804: HipA_C" amino acids 124 to 354 (231 residues), 162 bits, see alignment E=1.7e-51

Best Hits

Swiss-Prot: 52% identical to Y4ME_SINFN: Putative kinase Y4mE (NGR_a02540) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07154, (no description) (inferred from 78% identity to npp:PP1Y_Lpl1018)

Predicted SEED Role

"HipA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>GFF4825 Toxin HigB / Protein kinase domain of HipA (Sphingobium sp. HT1-2)
MHFIYADDWLADPAAGPLSHALPKQAEPFGDALCKAVFGGLLPEEGQRTAIARALGVSPD
NPFRLLAALGGDVAGALAFLPEGEKPPLPPEGELPPALDDAELAVLIGRLPRVPMLAGQG
GARLSLAGAQGKLPVVLAEGRVAVPRVGEPSTHLIKPEPDRFPGLAANEGFCLALARAVG
LDAAMAEWREVADKPYLLVTRYDRLDRDGHTIRLHQEDFAQAQGVPSNRKYASEGGPTFR
DCFALARQATTRPAREVLKLADAAIFNVIIGNADAHAKNYSLVRQSKGEVVLAPLYDLVA
THMWPELSAKLAMRFGRAATLEEINAGSFVRFAGDTGLALPFLRRRVAALAGRVREVISG
GVTVPGLDGTARLGELPSIVLDRAARLALKAEL