Protein Info for PS417_24645 in Pseudomonas simiae WCS417

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 13 to 46 (34 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 83 to 109 (27 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 482 to 501 (20 residues), see Phobius details PF20154: LNT_N" amino acids 18 to 181 (164 residues), 133.4 bits, see alignment E=8.5e-43 TIGR00546: apolipoprotein N-acyltransferase" amino acids 61 to 453 (393 residues), 299.8 bits, see alignment E=1.7e-93 PF00795: CN_hydrolase" amino acids 229 to 469 (241 residues), 93.5 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 80% identical to LNT_PSESM: Apolipoprotein N-acyltransferase (lnt) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 98% identity to pfs:PFLU5408)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCK2 at UniProt or InterPro

Protein Sequence (507 amino acids)

>PS417_24645 acyltransferase (Pseudomonas simiae WCS417)
MQRLTRPGWPGNLLAVVAGAITTLALAPFDVWPFALLAVGLFYIGLRDLSPRQALGRGWC
FGFGLFGAGTSWIYYSIHHFGGASVLLAGFLMLLFTAAIAWFFALPAWLWARWLRRNEAP
LADALTFAALWVGQEAFRGWFLTGFPWLYSGYSQLDGPLTGLAPVGGMWLISFALALTAA
LLCNLPRLLAGKRNAFIGAGLVLLVAPWAIGLALKHHAWTSPSGAPLSVAAIQGNVEQSM
KWDPEQLNAQLALYRDMSFTSKPVDLLVWPETAVPVLKESVEGYLGMMGKFAADRHTALI
TGVPIRQEVHHQKRYFNGITVVGEGDGTYLKQKLVPFGEYVPLQDMLRGLIAFFDLPMSD
FARGPSDQAMLQAKGYQIAPFICYEVVYPEFAAGLSAQSDLLLTISNDTWFGRSIGPLQH
LQMAQMRALEAGRWMIRATNNGVTGLINPFGQITAQIPQFERGILYGEVVPMHNLTPYLQ
WRSWPLIIVCLGLFGWALLAGRMAKTV