Protein Info for GFF4818 in Sphingobium sp. HT1-2

Annotation: Uncharacterized UPF0118 membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 310 to 338 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 338 (325 residues), 151.6 bits, see alignment E=1.8e-48

Best Hits

KEGG orthology group: None (inferred from 53% identity to eli:ELI_11740)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>GFF4818 Uncharacterized UPF0118 membrane protein (Sphingobium sp. HT1-2)
MISRERIDNGGLILFIAVSTVGLGLIISGFISALLWAALAALLFQPLYRHILIDCRGRRN
LAAALTLLIIIIAVIMPALIIGSLVVEQASGVYAKIRSGQIDFATYFGQVHAALPMRMQH
WVENAGFGTFERAQAKISQALSASASMLTQRALTIGADAAAFVLSFGVGLYVSFFLLRDG
EALAPQIIKRLPLEHAISHRIAARFVIVVRATIKGSGIVALAQGFLGAATFWIVGMPAAL
LWGVLMAIAALLPAIGPAIIWLPVATYLLASGDLWQAIAVIASGVFVIGLVDNLLRPMLV
GRDTGLPDWLILVTTLGGIETLGLSGIVVGPIAAAFFLTGWDILSEQKGATTCD