Protein Info for GFF4814 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Fe-S OXIDOREDUCTASE (1.8.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 PF08497: Radical_SAM_N" amino acids 33 to 417 (385 residues), 442.1 bits, see alignment E=1.5e-136 TIGR03904: uncharacterized radical SAM protein YgiQ" amino acids 33 to 684 (652 residues), 835 bits, see alignment E=1.4e-255 PF04055: Radical_SAM" amino acids 418 to 623 (206 residues), 44.1 bits, see alignment E=3.9e-15 PF11842: DUF3362" amino acids 632 to 745 (114 residues), 188.3 bits, see alignment E=1.5e-59

Best Hits

Swiss-Prot: 69% identical to Y4872_PSEPK: UPF0313 protein PP_4872 (PP_4872) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 87% identity to aaa:Acav_2779)

Predicted SEED Role

"Fe-S OXIDOREDUCTASE (1.8.-.-)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (772 amino acids)

>GFF4814 Fe-S OXIDOREDUCTASE (1.8.-.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNAPIDVSFFARAAKPITSYRPYWAKRFGVAPFLPMSRAEMEQLGWDSCDIILVTGDAYV
DHPSFGMAVVGRVLESQGFRVGIIAQPDWTSAEAFKALGKPNLFWGVTAGNMDSMINRYT
ADRKIRSDDAYTPGDVGGKRPDRAAIVYSQRCREAFKDVPIVLGGIEGSLRRIAHYDYWS
DKVRRSVVVDSKCDLLLYGNAERALVEVAHRIAAREPIEQITDVRGTAFVRRPGDPTAAG
WIEIDSSEVDTPGRVESHINPYQTTSEQAQSQGQSCAKEEGEATAEVNPAIQTLKFVPNP
SLQGKGRLKVPPRERSVIRLPSYEQVKSDAVLYAHANRVLHLETNPGNARALVQAHGEGT
TARDVWINPPPIPLTTAEMDHVFDLPYGRSPHPAYADEHGKHDGATKIPAWEMIRFSVNI
MRGCFGGCTFCSITEHEGRIIQSRSEESIIKEVEDIRDKVEGFTGVVSDLGGPTANMYRL
GCKSPEIEAACRKPSCVYPGICSNLHTDHGPLIKIYRRARELRGIKKILIGSGLRYDLAV
KSPEYVKELVQHHVGGYLKIAPEHTEGGPLSKMMKPGIGSYDRFKQLFEKFSEEAGKKQF
LIPYFIAAHPGTSDADMMNLAVWLKKNGFRADQVQTFYPSPMATATAMYHTNLNPLKGIH
RDDRAERVDIVRGDKRRRLHKAFLRYHDPNNWPLLREALKAMGRADLIGNGKHHLIPTFQ
PMTDGSYQSARRKNSTPVGNKVPGAQPGKGRLLTQHTGLPPRDTGSGKRKPR