Protein Info for PS417_24605 in Pseudomonas simiae WCS417

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 6 to 184 (179 residues), 202.3 bits, E=2.1e-64
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 6 to 197 (192 residues), 202.4 bits, E=2.2e-64

Best Hits

Swiss-Prot: 99% identical to THIE_PSEFS: Thiamine-phosphate synthase (thiE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 99% identity to pfs:PFLU5400)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See A0A1N7ULB9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PS417_24605 thiamine-phosphate pyrophosphorylase (Pseudomonas simiae WCS417)
MKLRGLYAITDSQLLAGKFLAYVEAALDGGVTLLQYRDKSSDEARRLREAEKLRELCSRY
KTQLIINDDAELAARLGVGVHLGQTDGPLTPARALLGSKAIIGSTCHSQIELAEQAAKEG
ASYVAFGRFFNSNTKPGAPAATVEMLAQARTRLQLPICVIGGITLENAEPLVAHGADLLA
VVHGLFGADSTQEVTRRARAFNALLKI