Protein Info for GFF481 in Sphingobium sp. HT1-2

Annotation: Ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 164 to 181 (18 residues), see Phobius details PF06325: PrmA" amino acids 50 to 306 (257 residues), 170.6 bits, see alignment E=5.7e-54 PF05175: MTS" amino acids 157 to 210 (54 residues), 28.2 bits, see alignment 1.4e-10

Best Hits

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 83% identity to sch:Sphch_1700)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF481 Ribosomal protein L11 methyltransferase (Sphingobium sp. HT1-2)
MNEVAAPAAQSWKVTLPCTRAEAEALDGDIAAFALVEHPPVLMTSEAEPDDENKWQLDAY
FEGKPSPAAIKLLKTLVPSASGIKPQVEALPDEDWVTMSQQGLEPVTAGRFHVRNVASDP
EQPGHVNFLIEASRAFGTGQHETTAGCLAMIDRMRGVGMRFRNVADIGTGTGLLAFAAMT
LWPRAHAIASDIDPVAVDISRENAVANGIALGGGAGQLALCTAAGVDHPALVGRAPYDLL
IANILAGPLIELAPSLCALVEDGGTIVLAGLLNEQADAVIAAYRAQGMRLAGRSDRGHWP
TLRLRKRPQIGWKRPRRINAAARGEAPGFGSI