Protein Info for GFF4808 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 28 to 271 (244 residues), 112.9 bits, see alignment E=7.9e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 51% identity to bpt:Bpet1167)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>GFF4808 hypothetical protein (Xanthobacter sp. DMC5)
MDDLKLPYWAAGVALVLAATLMVRDAYVASVINLIAVAALTAVSLRFVMLMGELNFATAA
FVGIGAYTTGAAVTILQWPFLIAILAGGLMAGLVAVAFGYVTLRTKGPYFLLIGFAFTEA
VRILYSKSTTLGGTSGMVGIFPPVALDAWMPTVIVGTSCALIFALYVLERSDFGKILTAI
RDNENVARTVGLNILLVKIACFAAASVAAGVAGSLHAFANNVISPGDFSFLVAAFALAYV
KVGGEDNIVGPLVGSVLLVVLGSYALGLGGDEHIFYGAAITLAVLLLPNGITGLLSGRRK
PSAAKGH