Protein Info for PS417_24595 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 183 to 205 (23 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 300 to 300 (1 residues), see Phobius details amino acids 303 to 303 (1 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 32 to 171 (140 residues), 145.5 bits, see alignment E=2.5e-46 PF07695: 7TMR-DISM_7TM" amino acids 184 to 386 (203 residues), 193.5 bits, see alignment E=1.1e-60 PF00512: HisKA" amino acids 419 to 483 (65 residues), 56.2 bits, see alignment E=7.4e-19 PF02518: HATPase_c" amino acids 530 to 644 (115 residues), 73.7 bits, see alignment E=4.1e-24 PF00072: Response_reg" amino acids 666 to 774 (109 residues), 49.9 bits, see alignment E=8.1e-17

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU5398)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1SB30 at UniProt or InterPro

Protein Sequence (796 amino acids)

>PS417_24595 histidine kinase (Pseudomonas simiae WCS417)
MRYLLIFLLSGLPLFANAIEFNQDTRSLPLGRAIQVLEDPTDALTIADVSAPSATPQFKP
HDKDTLNAGYSRSVFWLKVNLHYLPTQAEAQRTWLLELAYPPLDHLDLYLPDSSGTYRLA
GRTGDALPFSAREIRQNNYLFKVDFAPGEAKTVYLRLQSEGSIQAPLTLWSSTAYLEQQP
LRLYVLGLIYGVLLGMLVYNLFIYLSVRDTSYLYYIFYIASFGMYQLSVNGAAVEYFWPN
NPWWANAATPFLIGSAALFGSLFARSFLHTAQHSRWINRLLLALVACGGVVMLLSLMTSY
ALALRLATGLALVFTVTIFVAAIKAWYCGQRVARYFIIAWSAFLLGGVVNTLMVLGYLPN
VFLTMYASQIGSAIEVALLSLALADRINSMREQQAQILFDASQKLEVLNQQLARSNRLKD
EFLATLTHELRTPMNGVIGSLELMQTVPLDADLAQYHQTAAGSARDMMRMVNGILTLTEL
QAGRLSAQPQVFSLRGTLDTLRQQFTANAQSKGLAFSIDVADELPDRVLGDADKLLQSLD
CLLDNAFKFTHEGSVRLRVVGVPQSDGGLRLSFIVTDTGIGFAFLDEATLYQRFFQLDGS
TTREYGGLGIGLAICRQLIELLGGRLTHHSEPRKGSRFQLELEVSPVASDSKPAPDRQRA
PQECSVLLVDDNSVGQLVVRGMLLKLGYRVKTVDTGPNALAALQAGDFDAVLLDIPEGGF
SLCCQIRALPGCGELPVIALSTSLNVSERERCHGIGVSEHLVKPVRFEALQAVLERRLLC
PAEGESAAYSAGMPLF