Protein Info for GFF4807 in Variovorax sp. SCN45

Annotation: Uncharacterized GST-like protein yncG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 66 to 82 (17 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details PF02798: GST_N" amino acids 12 to 81 (70 residues), 28.1 bits, see alignment E=3e-10 PF13417: GST_N_3" amino acids 14 to 89 (76 residues), 31.6 bits, see alignment E=2.5e-11 PF13409: GST_N_2" amino acids 25 to 85 (61 residues), 35.2 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: K11208, GST-like protein (inferred from 82% identity to vap:Vapar_1853)

Predicted SEED Role

"Uncharacterized GST-like protein yncG" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF4807 Uncharacterized GST-like protein yncG (Variovorax sp. SCN45)
MSSSPSASNDRYTLYGAPGSGATPIHAALTLIGAQVDTVDIATWEGEAERERVSGVNPMR
QVPALVLPSGEVMTESAAILIWLGDRYPEAGLCPPPDSPLRARYLRWMVYLPAAIYSLHW
VRDDPARLVPDTASQSAMLERSAERMAHCWHLMDTQIGEPAPYLLGDRLGMLDLYVTVMS
RWTPRRARFYREAPRMAPVVKRVDADPRLADFWAARFPFTPGWETTGA