Protein Info for GFF4806 in Xanthobacter sp. DMC5

Annotation: High-affinity branched-chain amino acid transport ATP-binding protein LivF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to LIVF_METJA: Probable branched-chain amino acid transport ATP-binding protein LivF (livF) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 59% identity to bpa:BPP0367)

MetaCyc: 33% identical to LPS export ABC transporter ATP-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

MetaCyc Pathways

Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF4806 High-affinity branched-chain amino acid transport ATP-binding protein LivF (Xanthobacter sp. DMC5)
MTIESPSILPLEVRGLSARYGVVPALRDVDLVLRSGEIVTLIGANGAGKSTLIKAICGLV
RPTAGSVRLFGEEVTGLSPDRMVRKGLSVVPEGRRLFPEMTMLENLELGAFARHDAAAVK
RDLDRVISLFPELKDRLGTHAGTFSGGQQQMIAVARALMSAPRVLLLDEPTIGLAPAVVD
RIADIVTQIAHSGVNILLVEQNAETALAIADRAYILEGGAITAEDTAHALAASPDVQRAY
LGI