Protein Info for GFF4794 in Sphingobium sp. HT1-2

Annotation: Mg/Co/Ni transporter MgtE, CBS domain-containing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 320 to 338 (19 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details amino acids 421 to 445 (25 residues), see Phobius details amino acids 456 to 479 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 51 to 478 (428 residues), 292.9 bits, see alignment E=2e-91 PF03448: MgtE_N" amino acids 66 to 167 (102 residues), 88.6 bits, see alignment E=5.4e-29 PF00571: CBS" amino acids 170 to 217 (48 residues), 21.3 bits, see alignment 4.1e-08 amino acids 234 to 288 (55 residues), 35.3 bits, see alignment 1.8e-12 PF01769: MgtE" amino acids 352 to 475 (124 residues), 112.1 bits, see alignment E=3.3e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 76% identity to sjp:SJA_C1-06540)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>GFF4794 Mg/Co/Ni transporter MgtE, CBS domain-containing (Sphingobium sp. HT1-2)
MTERGDLAEPRPHEELADESLISAGMEQAESSLDEDDRLKPEFLSAVLDAVDEGDIDHAR
ELVSPLHPADIADLLELTPAEQRGEVAAALGDLVGAEVLSELNDYVRDDLIGALAPEQVA
EFASELDTDDAVAIIEDMEEADQQAVLEAMEPEDRAAIESALSYPEESAGRMMQRDLVAV
PEHMTVGQVIDYLRDNGDLTRDFWEIFVVDEGHKPIGTCQLSWVLTCPRGIAMADLMKRE
QTLIPVDMDQEEVALRFQKYALISAAVVDGSGRLVGMITVDDIVHIISEEAGEDILRLSG
AGEGDINEPVMDSYRARVRWLLTNLLTALVASTIIGIFENTIEKMVALATLMPIVAGVGG
NAGSQTMAVTVRALATNQITGSNARRTILREIRVALLNGCTVALVLGLGVGLVFHNVALG
GVIAAAMMTNIVTAGLAGAAVPLAFDRMNLDPAVASSIFVTMITDSMGFFAFLGLATAAG
LTG