Protein Info for PS417_24505 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF00892: EamA" amino acids 13 to 142 (130 residues), 62.8 bits, see alignment E=2.1e-21 amino acids 152 to 286 (135 residues), 72.1 bits, see alignment E=3e-24

Best Hits

Swiss-Prot: 56% identical to YEDA_ECOL6: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU5379)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULA1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PS417_24505 membrane protein (Pseudomonas simiae WCS417)
MPGPRRFPLPLIAAFFALYVIWGSTYLVIRIGVEYWPPLLLAGIRFCTAGALMYGFLRWR
GVPAPTWPQWKAAGMIGLLLLTVGNGGVSVAEHMGVSSGVAALAVATVPLFTLLCGYFWG
ARNTRLEWAGVILGIIGIAMLNMGSTLQSSPMGAVLLLVAAASWAFGSVWSRQLPLPQGA
MASAAEMLVAGVALLMVSALSGERLQAVPPLEGWLALAYLTVFGSIIAFNAYMYLLKHVR
PAAATSYAYVNPAVAVLLGIVFVGETIGLEEALAMLVIISAVLLISLPQWRKPKPEIR