Protein Info for GFF479 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 278 to 306 (29 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details PF05992: SbmA_BacA" amino acids 32 to 346 (315 residues), 55.1 bits, see alignment E=8.6e-19 PF06472: ABC_membrane_2" amino acids 32 to 243 (212 residues), 75.5 bits, see alignment E=4.7e-25

Best Hits

KEGG orthology group: None (inferred from 60% identity to bja:blr4660)

Predicted SEED Role

"putative ABC transporter-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF479 hypothetical protein (Xanthobacter sp. DMC5)
MSHDPYLPPDQRRLLSRFWESAAGFWRGGSAWRAWFLVALMVATVFLQLWTQYLLNFWNR
DFFDAVGRRDGQELWRQAQHFVPLAAASIFLAIVSVWGRITMQREWRQWLSSHLYDFWLG
GARSRRLRFMLGEHQTPEYRIAEDAKVATDVPVDLAVGLLSSVLNAITFIGVLWSVGGSL
VLPAFGRHITIPGYLVLAVVGYSALVTAAMMFIGRHLMRVLGESKRAEADLRAIGAHLRE
SGEHPLTPDARPDGRGVIGDALAKVIAQWRALCWQLMGMTLVSQTNLLLTPVIGLLLCMP
KYLVGLMSLGEVVQAAAAFTIVQAAFNWITDSYARLAEWRSSANRVASLLLALDEVKAEV
ERPANLDVAPESEGNGPRAQAGRPSGE