Protein Info for GFF4788 in Variovorax sp. SCN45

Annotation: Uncharacterized protein COG3236

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR02464: conserved hypothetical protein" amino acids 25 to 182 (158 residues), 159.7 bits, see alignment E=3.3e-51 PF08719: NADAR" amino acids 26 to 183 (158 residues), 177.8 bits, see alignment E=1e-56

Best Hits

KEGG orthology group: K09935, hypothetical protein (inferred from 64% identity to del:DelCs14_0838)

Predicted SEED Role

"Uncharacterized domain COG3236 / GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>GFF4788 Uncharacterized protein COG3236 (Variovorax sp. SCN45)
MTTTPRRIQDLLAYFAQGHRPEYLLFWGHQSPKSGVNKSCFSQWFEAEFTVDGIRYRTAE
HFMMAGKARLFGDDETCERILAARTPGEAKKLGREIRDFDEAAWVAARLDIVTRGNIEKF
AQNPALGAFLLGTGHQVLVEASPVDPIWGIGRAATDPAAQDPREWKGLNLLGFALMAARE
ALRSPRP