Protein Info for GFF4787 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details PF05227: CHASE3" amino acids 40 to 169 (130 residues), 92.4 bits, see alignment E=3.6e-30 PF02518: HATPase_c" amino acids 354 to 474 (121 residues), 64.7 bits, see alignment E=1.5e-21 PF00072: Response_reg" amino acids 501 to 611 (111 residues), 60.8 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: None (inferred from 71% identity to sjp:SJA_C1-06600)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>GFF4787 Two-component system sensor histidine kinase (Sphingobium sp. HT1-2)
MNALRPERSIVVLLLALATVIIAVGGTIWLYRSQQAEIGWVNHTLRVENRLSVILSRVQA
AESAQRGYMLTRQDPFLGPFDTFKADWPREIAQLRADVQDNADQAAAVDALGRMLDQRLT
LLEGGIELRRRGLPVDPNAFAPGLMAMATIHTHIAGMKAREEQLLRLRSVEANRLTTMVT
ASLAVSGALVIILGLLALRNARRRMVEAIAAKRALADANDRLVSEAEQRTAMEAQVRQLQ
KMESIGQLTGGIAHDFNNMLAVVIGSLDMARRRLPADIDRRISNGLDNATEGAQRAAQLT
ARLLAFSRQQPLAPQSTDVNKLVGGMSDMLRRTIGERVRVESVLAGGLWRASIDPGQLEA
AILNLCVNGRDAMPDGGRLTVETGNAYLDDAYAAAHAEVIPGQYVLVSVSDSGTGMTPDV
VERAFDPFFTTKGVGKGTGLGLSQVFGFVRQSHGHVKIYSEPGQGSTIKIYLPRHYGVPV
ADPVAPAIALDLPRAQGDEIILVVEDEDRVRHMSVDSLRELGYTIVQAADGEQALAMLAI
EPRVDLLFTDIVMPGINGRILADRARADRPELRVLYTTGYTRNAIVHNGMLDPGVAFLAK
PFTMDQLAGKVRQVLDEEPA