Protein Info for GFF4783 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF22622: MFE-2_hydrat-2_N" amino acids 19 to 146 (128 residues), 87.7 bits, see alignment E=8.7e-29 PF13452: FAS1_DH_region" amino acids 51 to 136 (86 residues), 29.5 bits, see alignment E=1.1e-10 PF01575: MaoC_dehydratas" amino acids 163 to 277 (115 residues), 95.9 bits, see alignment E=2.1e-31

Best Hits

Swiss-Prot: 36% identical to MFEB_DICDI: Probable enoyl-CoA hydratase 2 (mfeB) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 57% identity to pol:Bpro_5282)

Predicted SEED Role

"MaoC-like dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF4783 hypothetical protein (Xanthobacter sp. DMC5)
MAIDYEKLVTLAIPDVRQTYTARDTMLYALGVGLGHDPTSREQLRFVYEKALAALPTMAV
VLASPGSWMRDLDTGIDYVKVVHGEQGLVLHRPLPVEGTVVTRSRVVEVIDKGAGKGAVV
VSARELIDVVTGERIASITQSNFCRGDGGFGGPARPTPAPHKMPERSPDVICELRTNPNA
ALTYRLSGDYNPLHSDPDVAAKAGFPQPILHGLATYGVTGHAILKSVCDYDPTRLRAISA
RFTAPVFPGETFAVSIWRDGSVVSFETRSVERSVVAIGNGRAEIA