Protein Info for GFF4782 in Xanthobacter sp. DMC5

Annotation: 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00106: adh_short" amino acids 10 to 198 (189 residues), 142.4 bits, see alignment E=1.9e-45 PF08659: KR" amino acids 13 to 171 (159 residues), 72 bits, see alignment E=9.5e-24 PF13561: adh_short_C2" amino acids 19 to 250 (232 residues), 136.7 bits, see alignment E=1.5e-43

Best Hits

Swiss-Prot: 38% identical to FABG_STAEQ: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: None (inferred from 65% identity to dac:Daci_0196)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF4782 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase (Xanthobacter sp. DMC5)
MHTQKMMAGKVAVVTGGGRGIGRAIALGMAAEGAAVVVVDIGASLAGSGQDAGPAQEVVA
EIEAMGGEALASTLSIVEPANGERIVAAAVERFGRLDAVVNNAGILRDTMFHKMSYVDWT
DVIQVHLMGSFLLSRAAATQFREQNGGAYVHMTSTSGLIGNFGQANYMAAKMGIVGLSRA
IALDMQRYNVRSNCIAPFAWSRMTSSLPTETEEQRQRVKRFQQMTPEKIAPLAVWLASDK
AIDVSGQIFGVRNNELYLFSQPRPIRSVQISDGWTPELVASVAKGAFAAGLTPLERSSDV
FTWDPV