Protein Info for GFF4781 in Sphingobium sp. HT1-2

Annotation: SSU ribosomal protein S21p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 TIGR00030: ribosomal protein bS21" amino acids 1 to 56 (56 residues), 69.8 bits, see alignment E=6.6e-24 PF01165: Ribosomal_S21" amino acids 2 to 55 (54 residues), 73.7 bits, see alignment E=3.9e-25

Best Hits

Swiss-Prot: 96% identical to RS21_ZYMMO: 30S ribosomal protein S21 (rpsU) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K02970, small subunit ribosomal protein S21 (inferred from 93% identity to nar:Saro_2835)

Predicted SEED Role

"SSU ribosomal protein S21p" in subsystem Macromolecular synthesis operon or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (68 amino acids)

>GFF4781 SSU ribosomal protein S21p (Sphingobium sp. HT1-2)
MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRARKLERK
RAERDGVR