Protein Info for GFF4779 in Variovorax sp. SCN45

Annotation: Broad-specificity amino acid ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 27 to 27 (1 residues), see Phobius details amino acids 36 to 68 (33 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 288 to 292 (5 residues), see Phobius details amino acids 294 to 321 (28 residues), see Phobius details PF02653: BPD_transp_2" amino acids 32 to 304 (273 residues), 117.1 bits, see alignment E=4.2e-38

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 94% identity to vpe:Varpa_3997)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF4779 Broad-specificity amino acid ABC transporter, permease protein 2 (Variovorax sp. SCN45)
MNMKKISTVVYALLLLALVLAPFFGAYPVFVMKLMCFALFAAAFNLLLGFTGLLSFGHAA
FLGGSAYVAGHAMKVWGLTPELGLIAGTLTGAFLGWVFGVLAIRRQGIYFAMITLALAQM
MFFVALQAKFTGGEDGLQGVPRGKLFGLIDLSSDLTMYYVALVIVVAAFLLIVRTIHSPF
GQVLKGIKENEPRALSLGYDVSRFKLLAFVISAALSGLAGSLKTLVLGFATLSDVHWTAS
GQVILMTLVGGLGTLSGPLVGSAVVVLLENKIGELGSFLARITTIDWFNTLGESVTMVTG
LIFVICVLAFRKGIMGEIIAFIERRKGRVK