Protein Info for GFF4778 in Variovorax sp. SCN45

Annotation: Broad-specificity amino acid ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 186 to 214 (29 residues), see Phobius details amino acids 226 to 254 (29 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 279 (267 residues), 130 bits, see alignment E=4.8e-42

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to vpe:Varpa_3998)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF4778 Broad-specificity amino acid ABC transporter, permease protein 1 (Variovorax sp. SCN45)
MNISLPGLLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFAHGALFMLGAVLTWMAMEY
FGINYWVMLIAAPIVIGIFGVLIERLLLRWIYKLDHLYGLLLTLGLTLLIEGVFRSVYGV
SGLPYDAPDALSSATNLGFMVLPNYRAWVVVASLVICFATWYVIEKTRLGAYLRAGTENP
RLVEAFGVNVPLMITLTYAFGCALAAFAGVLAAPVMQVSPLMGQNLIIVVFAVVVIGGMG
SIMGAILTGLGLGVIEGFTKVFYPEASSTVVFVIMVIVLLIRPAGLFGKEK