Protein Info for GFF4778 in Sphingobium sp. HT1-2

Annotation: Uncharacterized UPF0118 membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 30 to 57 (28 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 240 to 268 (29 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF01594: AI-2E_transport" amino acids 33 to 341 (309 residues), 154.6 bits, see alignment E=2.1e-49

Best Hits

KEGG orthology group: None (inferred from 85% identity to sch:Sphch_2450)

Predicted SEED Role

"FIG00636993: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF4778 Uncharacterized UPF0118 membrane protein (Sphingobium sp. HT1-2)
LSDAQQHIEQPGPSELRSPLVQHEIKRAGVWFAMAIGIALIVLLAQPIMLILGALVFTTM
MDGGTRLLGRVLPIGRGWRLTIVLLAVVAFLAYTFYLTGSSLAAQAQAMRTIVEAQVERV
GGWMQQLGITTTPEDLKSLAQQAMSSMGRVTAAVGTAVGAITSGVMMLVLAIFIAVEPKL
YERGVAWMLPMDKRAHFYTVADKMAFTLRRLMFGRLIGMAVEGVGVWLLLWAGGVPMAGL
LGILTGLLAFLPNIGAIISGVLIVLVGFSGGTHTGLYAFGVYMAVQIIDGYLIVPMVAKR
ATDLAPALVLAAQILLGALFGILGLFLADPIVAMIKVYLEERSKALAGQTILKSDDKNGD