Protein Info for GFF4771 in Variovorax sp. SCN45

Annotation: Multidrug efflux system EmrAB-OMF, inner-membrane proton/drug antiporter EmrB (MFS type)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 343 to 361 (19 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 485 to 504 (20 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 23 to 502 (480 residues), 527.9 bits, see alignment E=1.2e-162 PF07690: MFS_1" amino acids 27 to 419 (393 residues), 179.8 bits, see alignment E=1.1e-56 PF06609: TRI12" amino acids 29 to 277 (249 residues), 39.5 bits, see alignment E=4e-14 PF00083: Sugar_tr" amino acids 44 to 192 (149 residues), 27.9 bits, see alignment E=1.8e-10

Best Hits

Swiss-Prot: 52% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 96% identity to vpe:Varpa_4004)

MetaCyc: 52% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>GFF4771 Multidrug efflux system EmrAB-OMF, inner-membrane proton/drug antiporter EmrB (MFS type) (Variovorax sp. SCN45)
MATAAPAYIAHPPLEGAARVWGTVALSAATFMNVLDSSIANVSLPAISGDLGVSTTQGTW
VITSFAVANAIAVPLTGFMTQRFGQVRLFMASVILFMVASLLCGLAPNMTTLILFRALQG
FVAGPMIPLSQTLLLSSYPRAKAGLAMAMWSMTTLVAPVMGPLLGGWITDNISWPWIFYI
NIPVGIVAASITWALYHKRESVTHKVPIDAIGLALLVLFVGSMQLMLDKGKELDWFHSPQ
IVTMAVVAVVGFAFFLVWELTDKHPVVDLSLFKRRNFWSGAVATAVAYGLFFGNVVLLPL
WLQQWMGYTATQAGMIMAPVGMLAIFFSPIVGLTVSKIDPRRYATFSFLVFALVLWMRSN
FNTQADFVTIIIPTVIQGIAMAFFFIPLVTITLSGLTPDRIPAASGLSNFLRITAGAMGT
SLTTTLWDNRATLHHTQLSETINQGNNAATSAMAGLGSSGFSTEQVLGQMNRIVDQQAYM
LATNDIFYASAILFLLLIPLVWLARPQKGGAGGDAAAGAH