Protein Info for GFF4770 in Sphingobium sp. HT1-2

Annotation: Heme O synthase, protoheme IX farnesyltransferase, COX10-CtaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01473: protoheme IX farnesyltransferase
  • amino acids 30 to 311 (282 residues), 319.6 bits, E=1.2e-99
• PF01040: UbiA
  • amino acids 45 to 287 (243 residues), 209.9 bits, E=1.9e-66

Best Hits

Swiss-Prot: 70% identical to COXX_SPHWW: Protoheme IX farnesyltransferase (ctaB) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 89% identity to sch:Sphch_2457)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Protein Sequence (316 amino acids)

>GFF4770 Heme O synthase, protoheme IX farnesyltransferase, COX10-CtaB (Sphingobium sp. HT1-2)
MGRRLIEEEFMASSPLSSGANAPVLPAHWRDFVALTKPRVMTLVVFTGLCGLLAAPGHIH
PVLGFTAILCIALGAGAAAALNQWWEADIDAKMKRTASRPLPAGRMERQTALHFGVGLSF
FSVILMGMATNWLAAAVLTVSILFYVFIYTIWLKPRTAQNIVIGGAAGAFPPVIGWAAVT
GDITALPIALFMLIFFWTPPHFWALALFVKTDYAAAGIPMLPVVSGEVVTRRQILFYTFI
MAVAALAPVALHLTGAIYGTAALVGTAIFAAMAFQVYLRRETDPARMAPEKRLFKYSILY
LFLLFGAVVVDRWLLA