Protein Info for PS417_02435 in Pseudomonas simiae WCS417

Annotation: flagellar motor protein MotA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 365.4 bits, see alignment E=8.7e-114 PF20560: MotA_N" amino acids 4 to 92 (89 residues), 95.6 bits, see alignment E=1.7e-31 PF01618: MotA_ExbB" amino acids 136 to 239 (104 residues), 41.1 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 40% identical to MOTA_AGRFC: Motility protein A (motA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 98% identity to pfs:PFLU0508)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUH6 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PS417_02435 flagellar motor protein MotA (Pseudomonas simiae WCS417)
MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVMIIGGAALGAFLQANPGYMTMHVIKK
SLGMFGSRFTHTFYLEVLGLVYEILNKSRREGMMAIEADIEDAAASPIFAKYPAVLKDER
MTAYICDYLRIMSSGNMAPHELEGLFDMELFSLKEELEHPSHAVTGIADGMPGFGIVAAV
LGIVVTMASLGEGDQAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEINLYES
IKASLVASASGMPPSLAVEFGRKVLYPKHRPSFAELEQAVRGR