Protein Info for GFF4767 in Xanthobacter sp. DMC5

Annotation: Long-chain-fatty-acid--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 226 to 248 (23 residues), see Phobius details PF00501: AMP-binding" amino acids 25 to 404 (380 residues), 258.4 bits, see alignment E=1e-80 PF13193: AMP-binding_C" amino acids 454 to 530 (77 residues), 70.4 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 50% identical to AAE11_ARATH: Butyrate--CoA ligase AAE11, peroxisomal (AAE11) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 64% identity to reu:Reut_C6109)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>GFF4767 Long-chain-fatty-acid--CoA ligase (Xanthobacter sp. DMC5)
MTSKYDVGLERRGANFRPLTPLHFLDRAAEVYPDRTAVIYGEVRYTWRMFAQRCRQLASA
LISAGIERGDTVSIFSLNTPAMLEAQFGIPLSGAVINCLNSRLDAPAVAFILAHSEARIF
LVDRQLAPVAQEALRLMEAPPRVIDIDDPSGADFPLLGDTEYETFIAAGDPAAELRWPQD
EWDAIALNYTSGTTGDPKGVVYHHRGAYLNALGQIINGRMTGARPVYLWTLPLFHCNGWC
FAWALAAVGGTQICMRKVSAEGMYQAISEHGVTLLCGAPIVLGFLADGAPSDWTPPAAPI
RVLSGGASPPAPVFKRLGELGFEVVHLYGMTEMHGVTTLCEPQEAWDDLDIDERMKHVAR
QGVRAVLADEMIVGDPLTLEPVPRDGQTIGEVFMRGNIAMKGYLKNPKATEEAFAADWYH
TGDLAVIHDDGYIEVKDRSKDIIISGGENISSIEVEEALYSHPWIAGAAVVAVPDPKWGE
TPCAVVELKPGAPGGITEADVIRYCRERLAAYKCPRHVLFEPLVRTATGKLQKFRLRTHA
AEQLAAKGRI