Protein Info for GFF4767 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 24 to 295 (272 residues), 170.3 bits, see alignment E=7.1e-54 PF00005: ABC_tran" amino acids 364 to 513 (150 residues), 115.2 bits, see alignment E=3.7e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 95% identity to vpe:Varpa_4008)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>GFF4767 Efflux ABC transporter, permease/ATP-binding protein (Variovorax sp. SCN45)
MAKGSPRSLSGLSPFLRPYRVQIVLAGVFLVMAAVTTLAFPIALRSLIDGGFVNPDKGAQ
TMALRDHFGALFAVAVALGLFSAARFYTVSWLGERVTADIRNAVYGRVLKQSPAFFETTQ
TGEVLSRLTADTTLVQTVVGSSLSMGLRNAVMGVGALAVLVWTNPYVMVQVLGILVLVVL
PSMWFGRRVRKLSRASQDRVADSSAIAAEVLNAIPVVQSYTAEGREASRFNGSTENAFRT
AVRRTKARSVLVAFIIIATSAALLWGLYQGTQAVLRGDITAGHLGQTVVYVAILASATAV
LGEVYGDLLRAAGATERLMELLHAPSAIFSPANPAVTPVPAAGSAIRFDAVTFHYPSRPG
TPALRDFSLDVAPGETVALVGSSGAGKSTVFQLLLRYYDPQSGRLILDGAPLASLALSDL
RTRIGLVPQDAVIFSTSAFENIRYGRPEATAEEVHAAARAAFAHDFLQALPEGYDTFLGE
RGVRLSGGQRQRIAIARAILKNPPLLLLDEATSALDAESERMVQAALESAMEGRTTLVIA
HRLATVQKADRIIVLDHGGIVEQGTHAALVAQGGVYARLAALQFTA