Protein Info for GFF4767 in Sphingobium sp. HT1-2

Annotation: Cytochrome c oxidase polypeptide III (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF00510: COX3" amino acids 7 to 267 (261 residues), 297.6 bits, see alignment E=5.4e-93

Best Hits

Swiss-Prot: 59% identical to COX3_PARDE: Cytochrome c oxidase subunit 3 (ctaE) from Paracoccus denitrificans

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 92% identity to sch:Sphch_2460)

MetaCyc: 53% identical to complex IV subunit 3 (Arabidopsis thaliana col)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF4767 Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Sphingobium sp. HT1-2)
MAGAKNHDYHILPPSIWPLFGSMSALVMAMGAIMWMHPDAMPAGGGWIFLIGVAGVLFTM
FSWWSNVIAEAHAGDHTPVVQLHLRYGMILFIASEVMFFVGWFWAFFDFSLFPSELAPIE
GMFPSKGIEVMNAFELPLLNTLILLCSGTTVTWAHHALIHGDREGLKKGLWCTVILGALF
SCIQAYEYMHAPFPFGGSPYSSAFYMATGFHGFHVLVGTIFLVVNLIRAYKGDFTPRQHF
GFEAAAWYWHFVDVVWLFLFAAIYVWGGWGAPIHGG