Protein Info for GFF4766 in Xanthobacter sp. DMC5

Annotation: 1,4-dihydroxy-2-naphthoyl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 11 to 258 (248 residues), 245.4 bits, E=6.1e-77
• PF16113: ECH_2
  • amino acids 16 to 190 (175 residues), 71.4 bits, E=1e-23

Best Hits

Swiss-Prot: 56% identical to MENB_BACSU: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 81% identity to reu:Reut_C6107)

MetaCyc: 68% identical to BadI (Rhodopseudomonas palustris)
3.7.1.-

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

• superpathway of chorismate metabolism (41/59 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
• superpathway of menaquinol-10 biosynthesis (5/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of menaquinol-9 biosynthesis (5/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (4/9 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• benzoyl-CoA degradation III (anaerobic) (3/9 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
• superpathway of phylloquinol biosynthesis (4/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Protein Sequence (261 amino acids)

>GFF4766 1,4-dihydroxy-2-naphthoyl-CoA synthase (Xanthobacter sp. DMC5)
MTGFTDILYEASGGVARITINRPDKYNAFRGQTCEELITAFNRAGWDKSVGVIVLTGAGD
KAFCTGGDQSAHDGGYDGRGLVGLPVEDLQTVIRDMPKPVIARVNGYAIGGGNVLVTCCD
LAIASETAQFGQVGPRVGSVDPGFGTALLARTVGEKKAREIWYLCRRYKAQESLEMGLVN
RVVPAAELDAEVARWCDEILALSPTAIAIAKRSFNADSESIRGISALGMQTLALFYETAE
SKEGVNAFMEKRKPRFRDTGE