Protein Info for GFF4766 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 PF01408: GFO_IDH_MocA" amino acids 6 to 122 (117 residues), 77.2 bits, see alignment E=7.8e-25 PF22725: GFO_IDH_MocA_C3" amino acids 131 to 253 (123 residues), 30.8 bits, see alignment E=1.2e-10 PF05368: NmrA" amino acids 372 to 480 (109 residues), 49.7 bits, see alignment E=1.8e-16 PF01370: Epimerase" amino acids 374 to 601 (228 residues), 110.7 bits, see alignment E=3.5e-35 PF01073: 3Beta_HSD" amino acids 375 to 598 (224 residues), 60.2 bits, see alignment E=8e-20 PF16363: GDP_Man_Dehyd" amino acids 376 to 537 (162 residues), 37.2 bits, see alignment E=1.1e-12 PF13460: NAD_binding_10" amino acids 378 to 540 (163 residues), 74.7 bits, see alignment E=4e-24 PF07993: NAD_binding_4" amino acids 452 to 561 (110 residues), 23.6 bits, see alignment E=1.2e-08

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (703 amino acids)

>GFF4766 Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSNKKKVLLVGAGNIAKTHAAALREIPDVELYGVFDVNAATAQGLAKEFGAGRVFPTIEE
AAASEADTVHVLTPPDFHLSSAMPFIAAGKTVLLEKPVGVSTAECEQMREAAARSGAVIG
VNQNLVFNPAYVQLKEAIASGRLGKPRYLDYVYEVPLRQLAARQFGHWMFRKPLNILLEQ
AVHPLSQVLDLAGSVRELSLLAEDPVEISPGVGLHNACQVSLRCERMPAHMRFHVGAEFT
VCRMTVVCDDGVAVADMFANQFHTLERTAYMEPVDAWLSARATGKQVVSQGFSVLRDYVM
ATAKLKPRSDPFYLGMKGSLQAFYRELQSQGKPRIDLDFGAELVSVCEQMVEGFKPLPER
AAPAPKVAPTGELVVVLGGTGFIGSHTVAALLDQGHPVRVMARGVSNLQPVFSRPGVEIV
RGDVKNKADLERAIAGAPYVVNLAHGGGGANFEAIRAAMVDSAVMVANVCREAGVKRMVH
VGSIASLFLGDAGETITGTTPPDPRPETRADYARAKTLADQALMDIHHQTGFPIVLMRPG
LVVGSGTSPFHSGLGFFNNDQHCVGWNGGQNALPWVLVGDCASAIVAAVNAPTAPGRAYN
LVGDVRPSAREYLADLSRTVGRPLKFVPSSPTGLWLVEMGKWLIKRVTGRAVPRPFKRDL
MSRGLLARIDCSNAKHDLGWKPVADPAEFHRQAMAVHAGDGSA