Protein Info for GFF4764 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF13439: Glyco_transf_4" amino acids 13 to 195 (183 residues), 88 bits, see alignment E=2e-28 PF13579: Glyco_trans_4_4" amino acids 14 to 192 (179 residues), 91 bits, see alignment E=2.7e-29 PF00534: Glycos_transf_1" amino acids 209 to 369 (161 residues), 68.1 bits, see alignment E=1.8e-22 PF13692: Glyco_trans_1_4" amino acids 218 to 358 (141 residues), 67.9 bits, see alignment E=2.9e-22 PF13524: Glyco_trans_1_2" amino acids 306 to 386 (81 residues), 25.8 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 73% identity to adk:Alide2_0700)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>GFF4764 Glycosyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKILYHHRTASKDGQAVHIEEMIEALRGEGHEVRVVSPAGDEPEAGATPGQGGGNGQMGS
DMGWVHRLKALMPKAVYELMELAYSLLAYRKLMKAARDFQPDVIYERYNLFLLSGLMAKK
RLGIPLLLEVNSPLVFERSQHSGGLALKALARWAEGVAWRGADCVLPVTNVLADHVRARG
VPESRIQVIPNGINRAHFAQAPTQAAAKAQLGLQGRLVLGFTGFVRDWHGVDRIVDWMAS
PQAPSHTHLLVVGDGPVREALEQQARRLGLADRVTFTGVIHRDRVPAHVAAFDVALQPAV
TPYASPLKLMEYLVLGKAVVAPATPNLREVLTHEDNALLFDEAVPTGMQDALTRLCTDDG
LRERLAVAAHDTIDRLSLTWTGNARRVVALSTSLAQASPTR