Protein Info for GFF4763 in Sphingobium sp. HT1-2

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10672: Methyltrans_SAM
  • amino acids 85 to 205 (121 residues), 31.6 bits, E=1.1e-11
• PF03602: Cons_hypoth95
  • amino acids 120 to 199 (80 residues), 24.6 bits, E=1.8e-09

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 88% identity to sch:Sphch_2464)

Predicted SEED Role

"SAM dependent methyltransferase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (289 amino acids)

>GFF4763 SAM-dependent methyltransferase (Sphingobium sp. HT1-2)
MELKTLIGEPWSDYGLIDSGNGRKLERYGRFRFIRPEPQAMWAPATEDWRADGEFIPGSD
EDGGGRWYYDKPVPAEGWPLHWKEVTFQSSCTPFRHLGFFPDMAPVWDFMRASTADKPEA
EVMNLFGYTGVGTLGMSAAGARMVHVDASKKSVAQARANADLSGMGDRPIRWIVEDAAKF
VAREVRRGRRYDGILLDPPKYGRGPDGEVWRLEEDLPGLIANCRQLLDADSRFLFLTVYA
VRMSALAIGELLRQAFADLPGEVEAGELTVREEARGLLLPTAIWARWKR