Protein Info for GFF4760 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 199 to 231 (33 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 280 to 293 (14 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details PF19358: DUF5935" amino acids 1 to 188 (188 residues), 53.8 bits, see alignment E=2.3e-18 TIGR03097: probable O-glycosylation ligase, exosortase A-associated" amino acids 2 to 420 (419 residues), 319 bits, see alignment E=2.2e-99 PF04932: Wzy_C" amino acids 205 to 352 (148 residues), 73.6 bits, see alignment E=1.5e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF4760 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRDLLVFGAMLLFVPLGLSNAFVGYLLWGWAGLIAMNSYVHGFMGVVPFVQLFALVTMGS
LLMRNGDRFERIEINRTTVLMMLFVVHGFFVALFAYPGLDRNWELFGNLTKTVLFCLLMP
VFVTSRYRIHAMVVMVVLATSFHGALDGLKFIASGGGHNARGIAKFGDNNHFAMVLLMVL
PLLYYLYQISSRKLAKAGFAVMLPLTAFAVVATASRGALIGLCVIVLFILMKSRNRVIGI
VIVAISVAVVVQLAPDSWSERMETIKTAKEDDSLLGRFGAWRVSSSIALSNPVFGGGFRA
VQSSVLWDGFKDGPTLLPFIEVAPSSPSGLAAHSIWFEVMGDMGFIGFFLFVALVANAFL
TRREILKLTKGRGPSLRWASDLADMLGAALLAFVVTGSLLSAAYFELPYIFLILMEVLKQ
HVLKTVAADSKAATKVLRPEPLSPPRPS