Protein Info for GFF4756 in Xanthobacter sp. DMC5

Annotation: Putrescine transport system permease protein PotH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 48 to 64 (17 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 204 to 230 (27 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 275 (192 residues), 52.1 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 58% identity to azc:AZC_1970)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF4756 Putrescine transport system permease protein PotH (Xanthobacter sp. DMC5)
MAGALDPKPRDWALTLPLAAFFALFFIAPLGLLVAISFETERQMTGTLGLGQYAAFLSDG
LNLAVLRDTLLVGAKATLLCLLFGYPLAWLCTKVSARWQAVLIFLVVLPIVTSVVVRTFA
WIVILGRHGIVNEAILALGLSAQPLKLLFSETGVVIVLAQVQMPLMVLPLITTLQRIDPN
LESASQALGAGAWRTFFKVTLPLSLPGIIAGTILTYTACVTAFVTQSLIGGSRLLFMPMM
IFQQAMDLQNWPFAAAVSVIFMVSVLLIVAMLVALSRSRAARLYG