Protein Info for GFF4750 in Variovorax sp. SCN45

Annotation: NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 87% identical to NUOA_LEPCP: NADH-quinone oxidoreductase subunit A (nuoA) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 97% identity to vpe:Varpa_4025)

MetaCyc: 40% identical to ferredoxin-plastoquinone oxidoreductase subunit C (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
NAD(P)/NADPH interconversion (3/6 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>GFF4750 NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3) (Variovorax sp. SCN45)
LPVASGEKLSMNLDSYLPVLLFILVGVGVGVAPQVIGYILGPNRPDAAKNAPYECGFEAF
EDARMKFDVRYYLVAILFILFDLEIAFLFPWAIALKEIGAVGFWAMMIFLAILVVGFAYE
WKKGALDWE