Protein Info for GFF4747 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 248 to 278 (31 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 160 to 327 (168 residues), 68.9 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 79% identity to xau:Xaut_2776)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF4747 hypothetical protein (Xanthobacter sp. DMC5)
MTDQLIETPAIAGVPRRRTRDRTERVPLWHTGLAAGSVWLAAAAYAGLVPDADDFAYTRE
FAFGLAGIGGLILLAALAGPVAGLRLKALRHWGPWLLILPLGLIAWEAVTAKLELLPRPF
FVPPQALLEVYLDDWPKLGLSVVASLKLLAWGYAIGAAVGITLGVSIGWWRIAGYWAHPV
LRFIGPLPATAWLPVAFFLFPSSWSASVFLLALATGFPVTILTWSGISSVNKDYYDIART
LGASQRFLVLKVAIPAALPHVFVGLFMGLGTSFAVLVVAEMLGVKAGLGWYLQWAQGWAA
YANMYAALLVMALMCSSLVTLLFRLRDRTLAWQKELVRW