Protein Info for GFF4744 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 140 (135 residues), 66.7 bits, see alignment E=1.3e-22 amino acids 159 to 293 (135 residues), 62.6 bits, see alignment E=2.4e-21

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_4031)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF4744 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MSERSKGMALCALAMVTVGSTVVASKVIAGGLPPFTATALRFAMALPVFLLLLRLTRTPW
PRPDRRDMALLLSQAGLGSVGYTVLLIMGVRWAPAASAGVVAGTLPAVAALVAVIALRER
PGRYLVGSIVLATAGVLAISWPGAGAASAGDSKSPAALLGNLLVLGAVVCEAMFILLNKR
LRVPVRPLALSTLMAAFGLLLSLVPALLERAWERPLPMAALAGVAYYALVPTVLGFVLWF
AGSSRLRGAEAALFTAILPVSALALAALWLGESISLAQIAGAACVLGAVGLASLDGRGSR
GHESPLKVAEL