Protein Info for GFF4742 in Xanthobacter sp. DMC5

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 75 to 102 (28 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details PF06609: TRI12" amino acids 11 to 184 (174 residues), 29.4 bits, see alignment E=3.1e-11 PF07690: MFS_1" amino acids 14 to 379 (366 residues), 177.5 bits, see alignment E=3.7e-56

Best Hits

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF4742 Hexuronate transporter (Xanthobacter sp. DMC5)
MAATRFHRVVIFLLFAITVVNYIDRAAISYAIPAIEQQLGLSKAAAGTILGAFGLGYAVT
TLIGGFAVDRYGARIVLSIAAVLWSLSIGLTGLASGFLTLYLARTLLGMAEGPNFSAVTG
AVERWLPPARQASALSYALVAVPVALACGGPIVTQLLAALGWRGTFAVLFALSLVWVPLW
YVLFRDDPAQSRHVNAQELAFIRDGQTAEAAPVRRWPRMSEVRVLLTNRTLLVNYWAFFV
FGYFLFFFMAWLPSYLQQSYGLNLAAVGAFTVLPWLCAAVALWALGRWSDHLLKTTGRLR
VSRSYLIAGTQLVAALAVVPVAFSASLPVAIACISLAVAASMGANAAYFAVNVDIVPEKA
ATALGIMDFCFALAGFVAPVITGFVLSLRGSFADGFGLMAVLALSSVVLVLAFHRPDEDR
AIP