Protein Info for GFF4736 in Xanthobacter sp. DMC5

Annotation: Respiratory nitrate reductase 1 gamma chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 164 to 179 (16 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details TIGR00351: respiratory nitrate reductase, gamma subunit" amino acids 3 to 228 (226 residues), 267.4 bits, see alignment E=6.1e-84 PF02665: Nitrate_red_gam" amino acids 7 to 227 (221 residues), 281.1 bits, see alignment E=3.1e-88

Best Hits

Swiss-Prot: 50% identical to NARI_ECOLI: Respiratory nitrate reductase 1 gamma chain (narI) from Escherichia coli (strain K12)

KEGG orthology group: K00374, nitrate reductase 1, gamma subunit [EC: 1.7.99.4] (inferred from 89% identity to azc:AZC_1428)

MetaCyc: 50% identical to nitrate reductase A subunit gamma (Escherichia coli K-12 substr. MG1655)
1.97.1.-; RXN0-3501 [EC: 1.7.5.1]; 1.7.5.1 [EC: 1.7.5.1]

Predicted SEED Role

"Respiratory nitrate reductase gamma chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.5.1 or 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF4736 Respiratory nitrate reductase 1 gamma chain (Xanthobacter sp. DMC5)
MSQAINSALFGWYPYLCLTVFLVGSLIRFDREQYTWKTGSSQLLRKRQLRWGSNLFHVGI
LVIFIGHAGGLLTPIWVFDALGISHSFKQGLAITVGGIAGVMCFIGIALLAHRRLFDPRI
RANSSFGDTAILLLLWVQLTLGLSTIFVSLHHMDGHEMVKFMNWAQGILTLQPAAAAYVA
DVSPIFKAHLVLGMTIFLVFPFTRLVHVWSAPVWYLGRPGYQVVRSRRPVRMPVAARPLP
ATAAVRPAARPLSNPAE