Protein Info for GFF4736 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 228 to 254 (27 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 343 to 370 (28 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 23 to 365 (343 residues), 137.8 bits, see alignment E=2.5e-44

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 44% identity to sml:Smlt1405)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF4736 hypothetical protein (Sphingobium sp. HT1-2)
MIRAFVDSARRETAFLRGSVWDLALVTWLPLLLLAIVAVQLSAGVMRNLPIVVVDEDGGG
VARDLTRKLEASPGLKVAARPPDMAQAEHLVRSNAAYAVVLIPRDLERTVLRGETGKILL
FYNASYSTPSGSVLREVGTVVQAHAKALAGEQSAAIAGPARVRPQPVSVQSRILYNPQTS
YELQLVALIHPALLHLLFMIAVVSALGRELRDGTIGAWLAGPRGEAVAAVAGKIAPYILI
FLLWGALATGYLAVYRGWPVQGSVAMLMGGYLALYLAYAGMALFIVGATLSMGQALSMTA
LYAGASFAFAGAIFPIESASAFARLWSALLPFTRFARLVAEQWMIGAPVLASLGSILALF
AFLVVGSGAGLPRYVSARMSPEVWGRR