Protein Info for PS417_24215 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 1 to 160 (160 residues), 239.8 bits, see alignment E=9.5e-76 PF03350: UPF0114" amino acids 9 to 125 (117 residues), 128.4 bits, see alignment E=8.4e-42

Best Hits

Swiss-Prot: 100% identical to Y5318_PSEFS: UPF0114 protein PFLU_5318 (PFLU_5318) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5318)

Predicted SEED Role

"Putative inner membrane protein (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U974 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PS417_24215 hypothetical protein (Pseudomonas simiae WCS417)
MERFIENAMYASRWLLAPIYFGLSLGLLALALKFFQEVIHLLPSVFSMAESELILVLLSL
IDMALVGGLLVMVMISGYENFVSQLDIDDNKEKLNWLGTMDSSSLKMKVAASIVAISSIH
LLRIFMDAKNVDPQHLMWYVIIHMTFVVSAFAMGYLDKVTKH