Protein Info for PS417_24200 in Pseudomonas simiae WCS417

Annotation: GCN5 family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF00583: Acetyltransf_1" amino acids 15 to 127 (113 residues), 46.6 bits, see alignment E=6e-16 PF13673: Acetyltransf_10" amino acids 41 to 132 (92 residues), 32.3 bits, see alignment E=1.4e-11 PF13508: Acetyltransf_7" amino acids 51 to 128 (78 residues), 36.4 bits, see alignment E=8.3e-13

Best Hits

KEGG orthology group: K00657, diamine N-acetyltransferase [EC: 2.3.1.57] (inferred from 63% identity to pay:PAU_02887)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.57

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7URT5 at UniProt or InterPro

Protein Sequence (145 amino acids)

>PS417_24200 GCN5 family acetyltransferase (Pseudomonas simiae WCS417)
MEISLTQITQQNYEAICELEVTEEQEDYVASNTWSLVEAAYNPGYFTRAIIADEEVVGFL
MWVQESKGKVSIWRFMVDKKHQQKSIGRAALGLALHEIKQIEELKEIEICYNPNNVVAKG
FYSSFGFIEVGMDADGEDMLARIIM