Protein Info for GFF4731 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: UDP-glucose dehydrogenase (EC 1.1.1.22)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 421 (421 residues), 459.2 bits, see alignment E=5.6e-142 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 186 (186 residues), 220.5 bits, see alignment E=2.1e-69 PF00984: UDPG_MGDP_dh" amino acids 204 to 297 (94 residues), 126 bits, see alignment E=7.8e-41 PF03720: UDPG_MGDP_dh_C" amino acids 321 to 425 (105 residues), 114.5 bits, see alignment E=4.3e-37

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 82% identity to dar:Daro_1284)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>GFF4731 UDP-glucose dehydrogenase (EC 1.1.1.22) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKITVVGTGYVGLVSGACLAEVGNDVLCLDVNPEKIRILEEGGIPIYEPGLQEMVSRNVA
AGRLHFTTDIDRAVNHGTIQFIAVGTPPDEDGSADMRYVLAAARNIGQRMTDYKVVVDKS
TVPVGTADRVKDAIAEELQKRGVQTPYSVVSNPEFLKEGAAVEDFMRPDRIIVGANDEQA
VHLMRALYAPFQRNRDRLIVTDVRSAELTKYAANAMLATRISFMNELANLAEKLGADIEM
VRQGIGSDPRIGYHFLYPGAGYGGSCFPKDVKALIKTAADDAGLDLKVLTAVEAANDAQK
HVLGDKVKRQLGADLKGRHFAVWGLAFKPNTDDMREAPSLELLADLLAAGATATAYDPVA
MHEAQRVLGDEPRVRYAQSPNEALEGADALIIVTEWKEFRSPDFDLIKAKLKQPLIVDGR
NLYDPAWVRSQGFDYLPIGR