Protein Info for GFF4725 in Xanthobacter sp. DMC5

Annotation: Bifunctional transcriptional activator/DNA repair enzyme Ada

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF02805: Ada_Zn_binding" amino acids 17 to 79 (63 residues), 100.6 bits, see alignment E=7.9e-33 PF00165: HTH_AraC" amino acids 107 to 137 (31 residues), 32.7 bits, see alignment (E = 1.3e-11) PF12833: HTH_18" amino acids 111 to 190 (80 residues), 63.9 bits, see alignment E=2.8e-21 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 277 to 356 (80 residues), 114.4 bits, see alignment E=9.4e-38 PF01035: DNA_binding_1" amino acids 278 to 357 (80 residues), 116.7 bits, see alignment E=6.7e-38

Best Hits

Swiss-Prot: 52% identical to ADA_SALTY: Regulatory protein ada (ada) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 67% identity to pde:Pden_4239)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>GFF4725 Bifunctional transcriptional activator/DNA repair enzyme Ada (Xanthobacter sp. DMC5)
MDPLTAAVPLSAEQDPRWAQVLGRDASVDGAFVYAVVTTGVYCRPSCPSRRADPRNVRFF
EDPAAAQAAGFRPCLRCQPIGPSPAERSTTIIAEACRRIEASGAPPKLDELAAAAGMSPW
HFHRRFKAVTGLTPRAYGAAHQARRVRAELEAAESGGVTEAIYGAGFSSSSRFYERSDGM
LGMTPTQFRSGGKDTDIRFAVGQCSLGAILVAVSPRGICAISLGDDPGTLVRELEDRFPA
ANLIGGDSAFETLVGQVIGFVQAPQMGLDLPLDVRGTAFQQRVWQALRDIPAGDTATYAD
VAARIGDAKAVRAVARACAANTLAVAIPCHRVVRSDGTLSGYRWGVERKRRLLETETED