Protein Info for GFF4725 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Formate hydrogenlyase transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 PF13185: GAF_2" amino acids 196 to 340 (145 residues), 38.7 bits, see alignment E=4.2e-13 PF01590: GAF" amino acids 197 to 339 (143 residues), 48.3 bits, see alignment E=5.4e-16 PF13492: GAF_3" amino acids 197 to 341 (145 residues), 40.1 bits, see alignment E=1.6e-13 PF00158: Sigma54_activat" amino acids 376 to 543 (168 residues), 241.7 bits, see alignment E=1.2e-75 PF14532: Sigma54_activ_2" amino acids 377 to 547 (171 residues), 74.4 bits, see alignment E=3.9e-24 PF00004: AAA" amino acids 400 to 518 (119 residues), 23.3 bits, see alignment E=2.6e-08 PF07728: AAA_5" amino acids 400 to 519 (120 residues), 30.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 100% identical to FHLA_SALTY: Formate hydrogenlyase transcriptional activator (fhlA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to cko:CKO_04087)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (687 amino acids)

>GFF4725 Formate hydrogenlyase transcriptional activator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSDLGQQGLFDITRTLLQQPDLASLSEALSQLVKRSALADSAGIVLWQAQSQRAQYYATR
ENGRPVEYEDETVLAHGPVRRILSRPDALHCNFHEFTETWPQLAASGLYPEFGHYCLLPL
AAEGRIFGGCEFIRQEDRPWSEKEYDRLHTFTQIVGVVAEQIQNRVNNNVDYDLLCRERD
NFRILVAITNAVLSRLDIDELVSEVAKEIHHYFNIDAISIVLRSHRKNKLNIYSTHYLDE
HHPAHEQSEVDEAGTLTERVFKSKEMLLINLNERDPLAPYERMLFDTWGNQIQTLCLLPL
MSGKTMLGVLKLAQCEEKVFTTANLKLLRQIAERVAIAVDNALAYQEIHRLKERLVDENL
ALTEQLNNVDSEFGEIIGRSEAMYNVLKQVEMVAQSDSTVLILGETGTGKELIARAIHNL
SGRSGRRMVKMNCAAMPAGLLESDLFGHERGAFTGASAQRIGRFELADKSSLFLDEVGDM
PLELQPKLLRVLQEQEFERLGSNKLIQTDVRLIAATNRDLKKMVADREFRNDLYYRLNVF
PIQLPPLRERPEDIPLLVKAFTFKIARRMGRNIDSIPAETLRTLSSMEWPGNVRELENVV
ERAVLLTRGNVLQLSLPDITAVTPDTSPVATESDKEGEDEYQLIIRVLKETNGVVAGPKG
AAQRLGLKRTTLLSRMKRLGIDKDALA