Protein Info for GFF4720 in Variovorax sp. SCN45

Annotation: Putrescine transport system permease protein potI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 263 to 288 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 291 (203 residues), 40.8 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 94% identity to vap:Vapar_3536)

Predicted SEED Role

"Putrescine transport system permease protein potI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF4720 Putrescine transport system permease protein potI (Variovorax sp. SCN45)
MSQHIREKRAPGFWPLATVFGLFVLFLYGPMITIFVLSFQGPEGGLTFPLRGVSLHWFHK
LAEGLGTVDIGAAFRRSLALGAVVMAFTVVLSVLAGLSFRKKLAGSNALFFVTVASLIMP
SIIISLGIGLQFRLIDTGIKSMLTAMDATTLLEGYGTALGLFSSALGAHLTWTLPFGLLI
MFAVFNRFNPAYEEAARDLGATPWQTFRFVVLPLIGPSIVGIGMFGFTLSWDEIARTSQA
IGDVNTLPLELQGLTSTVTTPSIYALGTVTTVVSLLVMAVALGAAALLRRRSTLKR