Protein Info for GFF472 in Sphingobium sp. HT1-2

Annotation: Chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF00226: DnaJ" amino acids 12 to 74 (63 residues), 87.4 bits, see alignment E=1.1e-28 TIGR02349: chaperone protein DnaJ" amino acids 12 to 363 (352 residues), 432.5 bits, see alignment E=7.4e-134 PF01556: DnaJ_C" amino acids 132 to 346 (215 residues), 164.8 bits, see alignment E=3e-52 PF00684: DnaJ_CXXCXGXG" amino acids 159 to 219 (61 residues), 57.7 bits, see alignment E=2.3e-19 PF27439: DnaJ_C_2" amino acids 352 to 385 (34 residues), 35.4 bits, see alignment 1.7e-12

Best Hits

Swiss-Prot: 67% identical to DNAJ_ZYMMO: Chaperone protein DnaJ (dnaJ) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 91% identity to sch:Sphch_2945)

MetaCyc: 54% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF472 Chaperone protein DnaJ (Sphingobium sp. HT1-2)
VRAEGEMTTEIDYYELLEVERTADGAAIKSAYRKLAMKYHPDKTGGCTDSEAKFKAVSEA
YDCLKDPQKRAAYDRFGHAAFKQQQQGGGGGGFHGGAGGFSDLGDIFETIFGQAGFGGGG
SGRQQQRRGADLRYDLEISLDEAYHGKKTEIQIEVSAACDSCEGSGAQPGTGVKTCGTCH
GHGQVRAQQGFFVVERTCPSCHGAGQVIESPCKSCRGEGRVDRPKTLSVNIPAGVDEGTR
IRLSGEGEAGARGAPAGDLYIFLHVKRHSIFERDGTTLFCRVPVSITTAALGGMIEVPGL
DGQRHEIKIPSGIQSGKQIKQRGAGMPVLNGRGQGDLVVQVDVETPTKLTAKQRELLEAF
RETETGEECPQSSGFFGKLKELWGD