Protein Info for GFF4715 in Variovorax sp. SCN45

Annotation: Fatty acid hydroxylase family (carotene hydroxylase/sterol desaturase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 208 to 341 (134 residues), 105.4 bits, see alignment E=1.6e-34

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_3537)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>GFF4715 Fatty acid hydroxylase family (carotene hydroxylase/sterol desaturase) (Variovorax sp. SCN45)
MLDIDKLNDFTQNHGELRRGQGLVTGTIALSLAILCFLGVLAFHFPQYLTTPELRKSYNV
DVMRYILLTALVIAGGLSLVNIIFNRSRWLSSAAFLLVAASALLGGHKVPVHDFADHTPY
IGLDWFILDLLGSSLIFIFIEKLFALRKDQPVFREEWQTDFHHFVVNHMIVGFVLLATNL
MVHKLFGWAANDGIRGWVGNLPFWAGLLLIILVADLVQYWTHRAYHEVPVLWRLHAVHHS
VKSMDWMAGSRQHILELLITRTLVLAPIYVLGFSKEVIDAYIVVVGFQAVFNHCNVSVRL
GPLRYLIVTPNFHHWHHSQDIEALDKNYAAHYAFLDYIFGTAVKSTKLWPEKYGVLGDYV
PNGFFKQLKFPFVWKG